Loading...
Statistics
Advertisement

- YUIT -
www.yuit.it/

Yuit.it

Advertisement
Conversion Technology Metas Server
Yuit.it is hosted in Italy / Arezzo . Yuit.it doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: squid/3.5.14.

Technologies in use by Yuit.it

Technology

Number of occurences: 5
  • CSS
  • Html
  • Javascript
  • Php
  • Swf Object

Advertisement

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • squid/3.5.14

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Yuit.it

Missing HTTPS protocol.

    Meta - Yuit.it

    Number of occurences: 1
    • Name:
      Content: 0; url=http://www.yuit.it/yu/

    Server / Hosting

    • IP: 31.11.32.124
    • Latitude: 43.42
    • Longitude: 11.88
    • Country: Italy
    • City: Arezzo

    Rname

    • dns.technorail.com
    • dns4.arubadns.cz
    • dns2.technorail.com
    • dns3.arubadns.net
    • mx.yuit.it

    Target

    • hostmaster.technorail.com

    HTTP Header Response

    HTTP/1.1 403 Forbidden Server: squid/3.5.14 Mime-Version: 1.0 Date: Sun, 03 Jul 2016 11:57:52 GMT Content-Type: text/html;charset=utf-8 Content-Length: 4 X-Squid-Error: ERR_ACCESS_DENIED 0 X-Cache: MISS from s_xt50 X-Cache-Lookup: NONE from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive

    DNS

    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.72
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.74
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.160
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.157
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.154
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.166
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.163
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.151
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns.technorail.com
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns4.arubadns.cz
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns2.technorail.com
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns3.arubadns.net
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: SOA
    4. mname: dns.technorail.com
    5. rname: hostmaster.technorail.com
    6. serial: 1
    7. refresh: 86400
    8. retry: 7200
    9. expire: 2592000
    10. minimum-ttl: 86400
    host: yuit.it
    1. class: IN
    2. ttl: 21600
    3. type: MX
    4. pri: 10
    5. target: mx.yuit.it

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.uit.it, www.yzuit.it, www.zuit.it, www.yauit.it, www.auit.it, www.ysuit.it, www.suit.it, www.yduit.it, www.duit.it, www.yuit.it, www.uit.it, www.ycuit.it, www.cuit.it, www.y uit.it, www. uit.it, www.yit.it, www.yuwit.it, www.ywit.it, www.yueit.it, www.yeit.it, www.yusit.it, www.ysit.it, www.yuait.it, www.yait.it, www.yut.it, www.yuirt.it, www.yurt.it, www.yuift.it, www.yuft.it, www.yuivt.it, www.yuvt.it, www.yuikt.it, www.yukt.it, www.yui,t.it, www.yu,t.it, www.yuibt.it, www.yubt.it, www.yuigt.it, www.yugt.it, www.yuitt.it, www.yutt.it, www.yuiyt.it, www.yuyt.it, www.yuiut.it, www.yuut.it, www.yuijt.it, www.yujt.it, www.yuimt.it, www.yumt.it, www.yuint.it, www.yunt.it, www.yui.it, www.yuitq.it, www.yuiq.it, www.yuita.it, www.yuia.it, www.yuit .it, www.yui .it, www.yuitw.it, www.yuiw.it, www.yuite.it, www.yuie.it, www.yuitz.it, www.yuiz.it, www.yuitx.it, www.yuix.it, www.yuitc.it, www.yuic.it,

    Other websites we recently analyzed

    1. 8560.de - Diese Website steht zum Verkauf! - Informationen zum Thema 8 560.
      Diese Website steht zum Verkauf! 8560.de ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 8560.de alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.90
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    2. Charlemagne
      United Kingdom - 185.19.14.71
      Server software: Microsoft-IIS/7.5
      Technology: Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Tagmanager
      Number of Javascript: 9
      Number of meta tags: 3
    3. academiccredittransferpathway.ca
      Scottsdale (United States) - 184.168.221.46
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    4. Jich.de
      Germany - 88.198.231.9
      Server software: Apache/2.4.10 (Debian)
      Technology: CSS, Html, Html5, Javascript, jQuery
      Number of Javascript: 15
      Number of meta tags: 4
    5. nutritionnews.net
      Switzerland - 141.8.225.124
      Server software: Apache
      Technology: Html
    6. Home
      Servicios de Transporte Generales
      Scottsdale (United States) - 107.180.25.128
      Server software: Apache/2.4.23
      Technology: Carousel, CSS, Font Awesome, Html, Html5, Javascript, Php
      Number of Javascript: 14
      Number of meta tags: 4
    7. fishinggears.net
      Los Angeles (United States) - 208.73.210.100
      Server software: Microsoft-IIS/8.5
      Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    8. Home Page - Padre Pasquale Incoronato
      Padre Pasquale Incoronato,parroco della Parrocchia Santa Maria del Pilar in Ercolano, da alcuni anni si occupa del recupero sociale, familiare e personale, di minori definiti
      Arezzo (Italy) - 31.11.32.89
      Server software: Microsoft-IIS/8.5
      Technology: CSS, Html, Iframe, Javascript, Php, Swf Object
      Number of Javascript: 3
      Number of meta tags: 7
    9. imprimerepgraficas.es
      Germany - 217.160.230.20
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    10. Be Mom Strong – Don't settle for strong, Be Mom Strong!
      Don't settle for strong, Be Mom Strong!
      San Francisco (United States) - 192.0.78.12
      Server software: nginx
      Technology: Skimlinks, CSS, Feedburner, Google Font API, Gravatar, Html, Html5, Iframe, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Facebook Box, Twitter Button
      Number of Javascript: 9
      Number of meta tags: 10

    Check Other Websites